PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.GCV2U
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 252aa    MW: 27832.6 Da    PI: 9.4891
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.GCV2UgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.6e-144488147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
      Aradu.GCV2U 44 RESWTDEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 88
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-183894IPR009057Homeodomain-like
PROSITE profilePS5129415.8973993IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-74294IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-184291IPR006447Myb domain, plants
SMARTSM007172.6E-114391IPR001005SANT/Myb domain
PfamPF002491.9E-114488IPR001005SANT/Myb domain
CDDcd001673.76E-94689No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0032922Biological Processcircadian regulation of gene expression
GO:0043966Biological Processhistone H3 acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0048573Biological Processphotoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MNSNNTTSNT QSMVTPTPTA TTATTATDAS AKKVRKPYTI TKSRESWTDE EHDKFLEALQ  60
LFDRDWKKIE DFVGSKTVIQ IRSHAQKYFL KVQKNGTVAH VPPPRPKRKA AHPYPQKASK  120
NVLMALPASI AYAPSTNALA PGYATWDEAS LLGITQISNS SLNGVGNSTR KLLSSEIPKQ  180
GKPAPVIHGL PDFAEVYSFI GSVFDPDTNN HVEKLKEMDP INFETVLLLM RNLTVNLSSP  240
EFEPMVSFEI NS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00338DAPTransfer from AT3G09600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086730.0KF208673.1 Arachis hypogaea putative MYB-related protein 19 (MYB19) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015949252.11e-166PREDICTED: protein REVEILLE 8-like
SwissprotQ8RWU31e-120RVE8_ARATH; Protein REVEILLE 8
TrEMBLV5T8I91e-162V5T8I9_ARAHY; Putative MYB-related protein 19
STRINGGLYMA10G05560.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67353449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.21e-103MYB_related family protein